Low

TEXAS INSTRUMENTS  LP55231SQE/NOPB  LED-Treiber, 9 Ausgänge, Ladepumpe, 2.7V-5.5Vin, 1.25MHz Schaltfrequenz, 5.5V/25.5mAout, WQFN-24

TEXAS INSTRUMENTS LP55231SQE/NOPB
Technical Data Sheet (10.07KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The LP55231SQE/NOPB is a 9-channel LED Driver designed to produce lighting effects for mobile devices. A high-efficiency charge pump enables LED driving over full Li-ion battery voltage range. The device is equipped with an internal program memory, which allows operation without processor control. It has an I²C-compatible control interface with four pin-selectable addresses. The INT pin can be used to notify processor when a lighting sequence has ended (interrupt function). Also, the device has a trigger input interface, which allows synchronization, for example, between multiple LP55231 devices. Excellent efficiency is maintained over a wide operating range by autonomously selecting the best charge pump gain based on LED forward voltage requirements. The device is able to automatically enter power-save mode when LED outputs are not active, thus lowering idle current consumption down to 10µA (typical).
  • Adaptive high-efficiency 1x/1.5x fractional charge pump - efficiency up to 94%
  • LED drive efficiency up to 93%
  • Charge pump with soft-start
  • Overcurrent and short-circuit protection
  • Built-in LED test
  • Two-wire I²C-compatible control interface
  • Flexible instruction set
  • Large SRAM program memory
  • Small application circuit
  • Source (high-side) drivers
  • Architecture supports colour control
  • 200nA Typical standby current
  • 10µA (IVDD) Typical automatic power save mode
  • Green product and no Sb/Br

Produktspezifikationen

Bausteintopologie:
Ladungspumpe
Anzahl der Ausgänge:
9Ausgänge
Ausgangsstrom:
25.5mA
Ausgangsspannung:
5.5V
Bauform:
WQFN
Anzahl der Pins:
24Pin(s)
Eingangsspannung, min.:
2.7V
Eingangsspannung, max.:
5.5V
Schaltfrequenz:
1.25MHz
Betriebstemperatur, min.:
-40°C
Betriebstemperatur, max.:
85°C
Verpackung:
Stückweise
Produktpalette:
-
Qualifizierungsstandard der Automobilindustrie:
-
MSL:
MSL 1 - unbegrenzt
SVHC:
No SVHC (15-Jun-2015)

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • LED-Beleuchtung

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
MSL 1 - unbegrenzt
Herkunftsland:
United States

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85423990
Gewicht (kg):
.000012

Ähnliche Produkte

Sie können nach Produkten mit einer ähnlichen Funktionalität wie dieser suchen. Wählen Sie einen der folgenden Links aus. Sie gelangen dann auf eine Seite für Produktgruppen, auf der alle Produkte in dieser Kategorie aufgeführt werden, die über dieses bestimmte Attribut verfügen.