Low

ANALOG DEVICES  ADP191ACBZ-R7  Leistungsschalter, Logik-gesteuert, High-Side, Active-High, 1 Ausgang, 3.6V, 0.5A, WLCSP-4

ANALOG DEVICES ADP191ACBZ-R7
Technical Data Sheet (630.31KB) EN Technische Dokumentation anzeigen

Abbildung ggf. ähnlich. Alle Angaben ohne Gewähr. Ausschlaggebend sind die Produktinformationen des Herstellers.

Produktbeschreibung

The ADP191ACBZ-R7 is a high-side Load Switch designed for operation from 1.2 to 3.6V. This load switch provides power domain isolation for extended power battery life. The devices contain a low on-resistance P-channel MOSFET that supports more than 500mA of continuous current and minimizes power loss. The low 2µA (maximum) of ground current and ultralow shutdown current make the ADP191 ideal for battery-operated portable equipment. The built-in level shifter for enable logic makes the ADP191 compatible with modern processors and GPIO controllers. The ADP191 controls the turn-on slew rate of the switch to reduce the input inrush current. The ADP191 also incorporates an internal output discharge resistor to discharge the output capacitance when the ADP191 output is disabled.
  • Low RDSON of 105mR at 1.8V
  • Internal output discharge resistor
  • Turn-on slew rate limiting
  • Built-in level shift for control logic that can be operated by 1.2V logic

Produktspezifikationen

Leistungsschaltertyp:
High-Side
Eingangsspannung:
3.6V
Strombegrenzung:
500mA
Durchlasswiderstand:
0.08ohm
Bauform:
WLCSP
Anzahl der Pins:
4Pin(s)
Überhitzungsschutz:
Nein
Polarität der Eingänge On / Enable:
Aktiv-High
Anzahl der Ausgänge:
1Ausgänge
Betriebstemperatur, min.:
-40°C
Betriebstemperatur, max.:
85°C
Verpackung:
Gurtabschnitt
Produktpalette:
ADP191 Series
Qualifizierungsstandard der Automobilindustrie:
-
MSL:
MSL 1 - unbegrenzt

Finden Sie ähnliche Produkte  sortiert nach gemeinsamen Eigenschaften

Anwendungen

  • Tragbare Geräte

Gesetzgebung und Umweltschutz

Feuchtigkeitsempfindlichkeitslevel:
MSL 1 - unbegrenzt
Herkunftsland:
United States

Land, in dem der letzte Fertigungsprozeß ausgeführt wurde.

RoHS-konform:
Ja
Tarif-Nr.:
85423990
Gewicht (kg):
.000002

Zugehörige Produkte

Ähnliche Produkte